PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G001900.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 344aa    MW: 38920 Da    PI: 6.5127
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G001900.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-171461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd +l+ +++++G+g+W++++   g+ R+ k+c++rw +yl
  Aqcoe1G001900.3.p 14 KGPWTPEEDIILASYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                       79******************************99************97 PP

2Myb_DNA-binding47.34.9e-1567112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++T  E+  +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Aqcoe1G001900.3.p  67 RGNFTSHEERMIVHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 112
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.16965IPR017930Myb domain
SuperFamilySSF466897.59E-3011108IPR009057Homeodomain-like
SMARTSM007178.4E-141363IPR001005SANT/Myb domain
PfamPF002493.9E-161461IPR001005SANT/Myb domain
CDDcd001672.34E-101661No hitNo description
Gene3DG3DSA:1.10.10.606.3E-2465117IPR009057Homeodomain-like
SMARTSM007175.9E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129419.73266116IPR017930Myb domain
PfamPF002495.8E-1367112IPR001005SANT/Myb domain
CDDcd001672.64E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRPPCCDKD GIKKGPWTPE EDIILASYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TSHEERMIVH LQALLGNKWA SIASYLPQRT DNDIKNYWNT HLKKKIKKFQ  120
SATDSLVPSS NSSTFQLVTK RSSYSEKARS KEMTNLQTSV FKLNQTSTYA SSTENISRML  180
EGWMKSSPKT TMLRNDQEDN EDKQSNNYYY INKIQNGSTS STSSNNNNNT NNALDDPVVS  240
LQCNQADHEK AGHEEHSGLI SHDEFESLIF QNMGSIAWVK SETSHQGSEY SNSVEEKFHT  300
SSSVPGSEQT MEDQPPFSFL ENWLLDEASG QVEQQMMDLS TIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246153.11e-127PREDICTED: myb-related protein 306
TrEMBLU5FEG71e-122U5FEG7_POPTR; Uncharacterized protein
STRINGPOPTR_0019s06290.11e-122(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.16e-98myb domain protein 60